PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c13_8880V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 866aa    MW: 96672.9 Da    PI: 8.9203
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c13_8880V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.12.4e-09167211246
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        ++WT+ Ed++l+  v+ + +  W++Ia+++ + Rt+ qc  r+q 
  Pp3c13_8880V3.2.p 167 KPWTKAEDKKLLSIVQAHDMVEWAAIAEELDTQRTPAQCAIRYQR 211
                        69*****************************99**********96 PP

2Myb_DNA-binding51.22.9e-16219265148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        r +WT+eEde+l  av+++G ++W ++a++m  gR + qc srw k+l
  Pp3c13_8880V3.2.p 219 RSAWTPEEDEQLQAAVEKFGEKDWQSVAACME-GRLGSQCMSRWTKVL 265
                        789*****************************.***********9975 PP

3Myb_DNA-binding50.64.6e-16272318148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        rgrW +eEd +l+ av  +G++ Wk Ia++++ gR++ qc++rw ++l
  Pp3c13_8880V3.2.p 272 RGRWLAEEDTRLKWAVSVYGPRGWKNIAAHVP-GRSDVQCRERWCNVL 318
                        89******************************.***********9975 PP

4Myb_DNA-binding41.14.1e-13326366345
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         W++eEd +l ++v ++G ++W+++ +++g  Rt++qc  +w 
  Pp3c13_8880V3.2.p 326 EWSPEEDAKLEELVVKYGRHRWAAVGAELG--RTDNQCFRHWK 366
                        7****************************8..**********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.001472162IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-77591IPR009057Homeodomain-like
PROSITE profilePS500905.78475160IPR017877Myb-like domain
CDDcd001670.00518124159No hitNo description
Gene3DG3DSA:1.10.10.605.6E-7132170IPR009057Homeodomain-like
SuperFamilySSF466891.65E-14143214IPR009057Homeodomain-like
PROSITE profilePS500909.361161213IPR017877Myb-like domain
SMARTSM007173.0E-8165215IPR001005SANT/Myb domain
PfamPF139213.2E-15169230No hitNo description
Gene3DG3DSA:1.10.10.601.2E-12171221IPR009057Homeodomain-like
SuperFamilySSF466896.03E-17199266IPR009057Homeodomain-like
PROSITE profilePS5129415.872214266IPR017930Myb domain
SMARTSM007171.2E-14218267IPR001005SANT/Myb domain
CDDcd001672.94E-12221265No hitNo description
Gene3DG3DSA:1.10.10.602.6E-16222268IPR009057Homeodomain-like
SuperFamilySSF466891.87E-17245314IPR009057Homeodomain-like
PROSITE profilePS5129425.201267322IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.5E-19269321IPR009057Homeodomain-like
SMARTSM007173.5E-14271320IPR001005SANT/Myb domain
PfamPF002492.7E-14272318IPR001005SANT/Myb domain
CDDcd001673.97E-11274318No hitNo description
SuperFamilySSF466892.44E-22298369IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-14322366IPR009057Homeodomain-like
PROSITE profilePS5129414.962323372IPR017930Myb domain
SMARTSM007177.7E-13323371IPR001005SANT/Myb domain
CDDcd001679.06E-11326368No hitNo description
PfamPF002491.0E-11326366IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 866 aa     Download sequence    Send to blast
MQRRAVSLVE YQKACTRKFC GFTEVVNSSV ELIATKPASK KKSGEFKVRG PPENPDVEIY  60
RKLQSQLPAE FNVKKWTKKE TQALSKGVRQ QLQEIRLRAM MEGWDSDEEG QDFDEQMRTI  120
GENEEELKKG LPFIDWNEVA RIYVSGRSAW ECKLQWENNE NPLLNSKPWT KAEDKKLLSI  180
VQAHDMVEWA AIAEELDTQR TPAQCAIRYQ RSLNAAILRS AWTPEEDEQL QAAVEKFGEK  240
DWQSVAACME GRLGSQCMSR WTKVLHPDRH RRGRWLAEED TRLKWAVSVY GPRGWKNIAA  300
HVPGRSDVQC RERWCNVLDP SVKIDEWSPE EDAKLEELVV KYGRHRWAAV GAELGRTDNQ  360
CFRHWKLLHP EHKISFKKDM AIRRAALANN FVGREKERPD LGFQDFLPPP VAGEEEHNHP  420
ASPKSLTTST ENAVRKSGKR PSKKRKTPEL VSQSTDNFPT ETEVQAVVVD CADGSNSMPL  480
NSSNGAMRRQ AARPGGNAIK KRKLQVSTST DENILVEKEL QRAEGIASNG NQEVRVRSLK  540
KSRPKKAPKP VELSSKKMKS MELASETNDD LPIQTDLQII EVASADGSNV APLNSTKKSK  600
KRRSSNPGER AAKKRKTPEL VSAITENLLI EKDLQSVEVD SSNGNNAAPV NSVEESARIP  660
GSKLLCRRKK SPKRRVKTST KTRIPELALV LEEMLPIQNR VPSAGEVSGD GVSNDSMVTT  720
VEGARETSSV NGNYAQEPFV RGDTGNGGGA SDADLVEHRT NPILVSNVIC SPCNDAVKEK  780
RDEEDAELIV YTRRKNRVSS CSRTCSENTG AVELSATGTV TSGVGQDGRV HETDTTAGEL  840
IQEPILRRSR KKLTLPDFLY SGSKD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C6e-291183714159MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-291183714159MYB PROTO-ONCOGENE PROTEIN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1600615KRRSSNPGERAAKKRK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S52_54V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.28e-96myb domain protein 4r1